PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK29179.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 549aa    MW: 60517.3 Da    PI: 7.2592
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK29179.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.71.8e-31201258260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+k+++i+Y+g+H+h+k
  KFK29179.1 201 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGKITDIIYKGTHDHPK 258
                 8****************************************.***************85 PP

2WRKY106.81.1e-33372430159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  KFK29179.1 372 LDDGYRWRKYGQKVVRGNPNPRSYYKCTAAGCPVRKHVERASHDPKAVITTYEGKHNHD 430
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.778195259IPR003657WRKY domain
SuperFamilySSF1182901.28E-24198259IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.3E-27199259IPR003657WRKY domain
SMARTSM007741.2E-33200258IPR003657WRKY domain
PfamPF031064.0E-24201257IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-37357432IPR003657WRKY domain
SuperFamilySSF1182902.48E-29364432IPR003657WRKY domain
PROSITE profilePS5081138.825367432IPR003657WRKY domain
SMARTSM007747.7E-39372431IPR003657WRKY domain
PfamPF031064.0E-26373430IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MNSEVNDGKE FQVDPTARHD SAGGGGSARY KLMSPAKLPI SRSTDITIPP GLSPTSFLES  60
PVFISNIKPE PSPTTGSLFK PRPVHISVSS TSYTGRAFHQ NTFTEQKSSE FEFRPPASNM  120
VYAELDKHRS EPPVQFQGHG SSHSLSSLSE AAASSSELSR PAPPLQTTPT SSDIPAGSDQ  180
DESVQTSQND SRGSTPSILA DDGYNWRKYG QKHVKGSEFP RSYYKCTHPN CEVKKLFERS  240
HDGKITDIIY KGTHDHPKPQ PGRRNSGGLG MTSQEERLDK YPPLNGRDEK GSSVYNLSQA  300
VEQTGNPEGP PTSATDDGGE VAVSNRNKDD PDNDDPFTKR RRLEGTMDIT PLVKPIREPR  360
VVVQTLSEVD ILDDGYRWRK YGQKVVRGNP NPRSYYKCTA AGCPVRKHVE RASHDPKAVI  420
TTYEGKHNHD VPLSKSSSNH DNQPRFRQDE TDTISLNLGV GFSPDGPDHT SNEHQRQNQQ  480
LVNQSHPNGV GIRFVHATPM SSYYASLNSG MNQYGPRETQ NETQNGDISS LNHSSYPYPH  540
NIGRIQSGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-37199432877Probable WRKY transcription factor 4
2lex_A8e-37199432877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1338342KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529170.0AK352917.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-11-P10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283345.10.0hypothetical protein CARUB_v10004390mg
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A087GH270.0A0A087GH27_ARAAL; Uncharacterized protein
STRINGAT4G26640.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein